PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.HQQ60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 123aa    MW: 13683.9 Da    PI: 8.1219
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.HQQ60genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.92.3e-085891135
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgR 35
                     rg+W +eEd +l ++++++G g+W++ ++  g  +
      Aradu.HQQ60 58 RGKWIAEEDRILTQYIEEHGEGSWRSLPKNAG-LL 91
                     89**************************9999.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-114987IPR009057Homeodomain-like
PROSITE profilePS500907.08553102IPR017877Myb-like domain
PfamPF002491.1E-65892IPR001005SANT/Myb domain
SuperFamilySSF466891.24E-859122IPR009057Homeodomain-like
CDDcd001676.43E-46089No hitNo description
Gene3DG3DSA:1.10.10.603.7E-4102122IPR009057Homeodomain-like
PROSITE profilePS512949.14106123IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDTLHEAITI IILLVGVVSI PSSMMGRAPC CEKVELKRGK  60
WIAEEDRILT QYIEEHGEGS WRSLPKNAGL LSISSSTMGR APCCEKVGLK RGRWTAEEDR  120
ILT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015938283.12e-25PREDICTED: transcription factor MYB12
RefseqXP_016172314.12e-25PREDICTED: transcription factor MYB12
SwissprotP278982e-22MYBP_MAIZE; Myb-related protein P
TrEMBLA0A0D2QRE21e-24A0A0D2QRE2_G
STRINGMLOC_57220.19e-22(Hordeum vulgare)
STRINGGRMZM2G016020_P013e-23(Zea mays)
STRINGGRMZM2G087316_P013e-23(Zea mays)
STRINGGRMZM2G129872_P013e-23(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.11e-23myb domain protein 111